PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G007261.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family MYB
Protein Properties Length: 222aa    MW: 25136.7 Da    PI: 9.1271
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G007261.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.68.9e-163380148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
  HL.SW.v1.0.G007261.1 33 KGLWSPEEDERLMRYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 80
                          678*******************************************97 PP

2Myb_DNA-binding50.54.7e-1686130147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg+++++E+ l+++++  lG++ W+ Ia++++ gRt++++k++w++ 
  HL.SW.v1.0.G007261.1  86 RGAFSPQEEHLILHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 130
                           89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3882880IPR017930Myb domain
SuperFamilySSF466896.36E-2931127IPR009057Homeodomain-like
SMARTSM007175.1E-113282IPR001005SANT/Myb domain
PfamPF002493.5E-143380IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-233487IPR009057Homeodomain-like
CDDcd001674.51E-93680No hitNo description
PROSITE profilePS5129425.18681135IPR017930Myb domain
SMARTSM007171.6E-1485133IPR001005SANT/Myb domain
PfamPF002495.1E-1586130IPR001005SANT/Myb domain
CDDcd001678.92E-1088131No hitNo description
Gene3DG3DSA:1.10.10.606.6E-2688136IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MRKGNSDYDD DSSSGRSSSK NNSNKKVVVA MRKGLWSPEE DERLMRYMLT NGQGCWSDIA  60
RNAGLQRCGK SCRLRWINYL RPDLKRGAFS PQEEHLILHL HSILGNRWSQ IAARLPGRTD  120
NEIKNFWNST LKKRLKSVNN NNTSTTTTTT TTTSSSSPND SNSSEQDQLF TADHLVLNNN  180
INNNNNVGDQ PQQPMLTQQV PMHSDYYYYD YSSCSSSTTT AP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-283113525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130136LKKRLKS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008231282.16e-79PREDICTED: transcription factor MYB86-like
SwissprotQ9LXV23e-70MYB46_ARATH; Transcription factor MYB46
TrEMBLM5XMW61e-78M5XMW6_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s06630.11e-74(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.16e-63myb domain protein 46